Invitrogen™ beta-5 Tubulin Polyclonal Antibody

Rabbit Polyclonal Antibody

Brand:  Invitrogen™ PA580198

Product Code. 15915765

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human SiHa whole cell, human 293T whole cell, human HepG2 whole cell, monkey COS-7 whole cell, chicken heart tissue, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human testicular germ cell tumor tissue. ICC/IF: U20S cell. Flow: SiHa cell.

Microtubules, the major cytoskeletal elements found in all eukaryotic cells, consist of Tublin, which is a dimer of two 55kDa subunits: alpha and Beta. Microtubules play key roles in chromosome segregation in mitosis, intracellular transport, ciliary and flagellar bending, and structural support of the cytoskeleton. This antibody does not cause the 10-nm filaments to collapse into large lateral aggregates collecting in the cell periphery or tight juxtanuclear caps. It does not block microtubule assembly. Ab-3 does not inhibit polymerization or depolymerization of platelet tubulin in vitro. It blocks (by 70-80%) the ability of tubulin dimers (with GppNHp bound) to promote a stable inhibition of adenylyl cyclase.

Specifications

• Antigen: beta-5 Tubulin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: TUBB
• Gene Alias: AA408537; AI596182; B130022C14Rik; beta Ib tubulin; CDCBM6; CSCSC1; M(beta)5; M40; OK/SW-cl.56; tbb5; TUBB; TUBB1; TUBB5; tubulin beta; Tubulin beta chain; tubulin beta class I; tubulin beta-1 chain; tubulin beta-5 chain; tubulin, beta 5 class I; tubulin, beta class I; tubulin, beta polypeptide
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 203068, 22154, 29214, 396254
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P07437, P09244, P69897, P99024
• Gene Symbols: TUBB, Tubb5
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat, Monkey, Chicken
• Product Type: Antibody
• Isotype: IgG