missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beta Ig-h3/TGFBI Rabbit anti-Human, Mouse, Rat, Clone: 7Q5O9, Novus Biologicals™
Shop All Bio Techne ProductsDescription
Beta Ig-h3/TGFBI Monoclonal antibody specifically detects Beta Ig-h3/TGFBI in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
Specifications
| Antigen | Beta Ig-h3/TGFBI |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Clone | 7Q5O9 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | Beta ig-h3, BIGH3EBMD, CDB1, CDG2, CDGG1transforming growth factor, beta-induced, 68kD, CSD, CSD1, CSD2, CSD3, Kerato-epithelin, LCD1, RGD-CAP, RGD-containing collagen-associated protein, transforming growth factor, beta-induced, 68kDa, transforming growth factor-beta-induced protein ig-h3 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Beta Ig-h3/TGFBI (Q15582). AVQKVIGTNRKYFTNCKQWYQRKICGKSTVISYECCPGYEKVPGEKGCPAALPLSNLYETLGVVGSTTTQLYTDRTEKLRPEMEGPGSFTIFAPSNEAWAS |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?