Beta 2 Adaptin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-56481

Product Code. 18258462

Description

Beta 2 Adaptin Polyclonal specifically detects Beta 2 Adaptin in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Beta 2 Adaptin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, adaptor-related protein complex 2, beta 1 subunit, ADTB2adaptin, beta 2 (beta), AP105B, AP2-BETA, Beta-2-adaptin, Beta-adaptin, CLAPB1AP-2 complex subunit beta, Clathrin assembly protein complex 2 beta large chain, clathrin-associated/assembly/adaptor protein, large, beta 1, DKFZp781K0743, Plasma membrane adaptor HA2/AP2 adaptin beta subunit
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 163
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P63010
• Gene Symbols: AP2B1
• Immunogen: Synthetic peptides corresponding to AP2B1(adaptor-related protein complex 2, beta 1 subunit) The peptide sequence was selected from the middle region of AP2B1. Peptide sequence SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVTAKEVVLSEKP.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: beta.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG