missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18328837

Beta 2 Adaptin Antibody (2D5), Novus Biologicals™

Product Code. 18328837 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18328837 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18328837 Supplier Novus Biologicals Supplier No. H00000163M01

Please to purchase this item. Need a web account? Register with us today!

This item is currently unavailable or has been discontinued.
View the product page for possible alternatives.
 View alternative products

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

Beta 2 Adaptin Monoclonal antibody specifically detects Beta 2 Adaptin in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen Beta 2 Adaptin
Applications Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 2D5
Conjugate Unconjugated
Dilution Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_001273
Gene Alias Adapter-related protein complex 2 beta subunit, Adaptor protein complex AP-2 subunit beta, adaptor-related protein complex 2, beta 1 subunit, ADTB2adaptin, beta 2 (beta), AP105B, AP2-BETA, Beta-2-adaptin, Beta-adaptin, CLAPB1AP-2 complex subunit beta, Clathrin assembly protein complex 2 beta large chain, clathrin-associated/assembly/adaptor protein, large, beta 1, DKFZp781K0743, Plasma membrane adaptor HA2/AP2 adaptin beta subunit
Host Species Mouse
Immunogen AP2B1 (NP_001273.1, 585 a.a. ~ 651 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SHGIHRKHLPIHHGSTDAGDSPVGTTTATNLEQPQVIPSQGDLLGDLLNLDLGPPVNVPQVSSMQMG
Purification Method Protein A purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 163
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.