missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£222.00 - £470.00
Specifications
| Antigen | beta-1,4-Galactosyltransferase 2/B4GalT2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18266523
|
Novus Biologicals
NBP2-58906 |
100 μL |
£470.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18637946
|
Novus Biologicals
NBP2-58906-25ul |
25 μL |
£222.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
beta-1,4-Galactosyltransferase 2/B4GalT2 Polyclonal specifically detects beta-1,4-Galactosyltransferase 2/B4GalT2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| beta-1,4-Galactosyltransferase 2/B4GalT2 | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| B4Gal-T2, B4Gal-T3, beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, beta-4-GalT2, beta4Gal-T2, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2 | |
| B4GALT2 | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 8704 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PYAGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPDIRIGRYRMIKHDRDKHNEPNPQRFTKIQNTKLTMKRDGIGSVRYQVLEVSRQPLFTNITV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title