missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta-1,4-Galactosyltransferase 2/B4GalT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59837
This item is not returnable.
View return policy
Description
beta-1,4-Galactosyltransferase 2/B4GalT2 Polyclonal specifically detects beta-1,4-Galactosyltransferase 2/B4GalT2 in Human samples. It is validated for Western Blot.
Specifications
| beta-1,4-Galactosyltransferase 2/B4GalT2 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| B4Gal-T2, B4Gal-T3, beta-1,4-galactosyltransferase 2, Beta-1,4-GalTase 2, beta-4-GalT2, beta4Gal-T2, beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 2, EC 2.4.1.-, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 2, UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2, UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 2, UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 2, UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 2 | |
| Rabbit | |
| 42 kDa | |
| 100 μL | |
| Lipid and Metabolism | |
| 8704 | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O60909 | |
| B4GALT2 | |
| Synthetic peptides corresponding to B4GALT2 (UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 2) The peptide sequence was selected from the middle region of B4GALT2. Peptide sequence AGYFGGVSGLSKAQFLRINGFPNEYWGWGGEDDDIFNRISLTGMKISRPD The peptide sequence for this immunogen was taken from within the described region. | |
| Affinity purified | |
| RUO | |
| Primary | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction