missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Antibody (2H6), Novus Biologicals™
Shop All Bio Techne ProductsDescription
Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 Monoclonal antibody specifically detects Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 in Human samples. It is validated for ELISA
Specifications
Specifications
| Antigen | Beta-1,3-N-Acetylglucosaminyltransferase 1/B3GNT1 |
| Applications | ELISA |
| Classification | Monoclonal |
| Clone | 2H6 |
| Conjugate | Unconjugated |
| Formulation | In 1x PBS, pH 7.4 |
| Gene Accession No. | NP_006867 |
| Gene Alias | B3GN-T1, beta-1,3-N-acetylglucosaminyltransferase bGnT-6, BETA3GNTI, EC 2.4.1.149, i-beta-1,3-N-acetylglucosaminyltransferase, iGAT, IGNT, N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase, Poly-N-acetyllactosamine extension enzyme, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 1B3GNT6, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 6 |
| Host Species | Mouse |
| Immunogen | B4GAT1 (NP_006867.1, 316 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AYVVPWQDPWEPFYVAGGKVPTFDERFRQYGFNRISQACELHVAGFDFEVLNEGFLVHKGFKEALKFHPQKEAENQHNKILYRQFKQELKAKYPNSPRRC |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?