missing translation for 'onlineSavingsMsg'
Learn More
Learn More
beta-1,3-Glucuronyltransferase 1/B3GAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£317.00 - £530.00
Specifications
| Antigen | beta-1,3-Glucuronyltransferase 1/B3GAT1 |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18673265
|
Novus Biologicals
NBP3-21368-100ul |
100 μg |
£530.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18619104
|
Novus Biologicals
NBP3-21368-25ul |
25 μg |
£317.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
beta-1,3-Glucuronyltransferase 1/B3GAT1 Polyclonal antibody specifically detects beta-1,3-Glucuronyltransferase 1/B3GAT1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| beta-1,3-Glucuronyltransferase 1/B3GAT1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Immunology | |
| PBS, pH 7.2, 40% glycerol | |
| 27087 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| Beta-1,3-glucuronyltransferase 1, beta-1,3-glucuronyltransferase 1 (glucuronosyltransferase P), EC 2.4.1.135, galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1, GlcAT-P, GLCATPGLCUATP, glcUAT-P, Glucuronosyltransferase P, NK1, NK-1, UDP-GlcUA:glycoprotein beta-1,3-glucuronyltransferase | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: LVVEDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRETFPRN | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title