missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BET1L Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
£151.00 - £359.00
Specifications
| Antigen | BET1L |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18672421
|
Novus Biologicals
NBP2-92050-0.02ml |
0.02 mL |
£151.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18678090
|
Novus Biologicals
NBP2-92050-0.1ml |
0.1 mL |
£359.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
BET1L Polyclonal antibody specifically detects BET1L in Human samples. It is validated for Western BlotSpecifications
| BET1L | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS with 50% glycerol, pH7.3. | |
| 51272 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| blocked early in transport 1 homolog (S. cerevisiae)-like, golgi integral membrane protein 3, golgi SNARE 15 kDa protein, golgi SNARE with a size of 15 kDa, GS15, HSPC197, vesicle transport protein GOS15 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-60 of human BET1L (NP_057610.2). MADWARAQSPGAVEEILDRENKRMADSLASKVTRLKSLALDIDRDAEDQNRYLDGMVRAH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Ser du en mulighed for forbedring?Del en indholdskorrektion
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel