missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BET1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92710-0.1ml
This item is not returnable.
View return policy
Description
BET1 Polyclonal antibody specifically detects BET1 in Human samples. It is validated for Western Blot
Specifications
| BET1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| Bet1 (S. cerevisiae) homolog, BET1 homolog, BET1 homolog (S. cerevisiae), Bet1p homolog, blocked early in transport 1 homolog (S. cerevisiae), DKFZp781C0425, Golgi vesicular membrane trafficking protein p18, Golgi vesicular membrane-trafficking protein p18, HBET1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-94 of human BET1 (NP_005859.1). MRRAGLGEGVPPGNYGNYGYANSGYSACEEENERLTESLRSKVTAIKSLSIEIGHEVKTQNKLLAEMDSQFDSTTGFLGKTMGKLKILSRGSQT | |
| 0.1 mL | |
| Signal Transduction | |
| 10282 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction