missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BEN Domain Containing 5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-31701
This item is not returnable.
View return policy
Description
BEN Domain Containing 5 Polyclonal specifically detects BEN Domain Containing 5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| BEN Domain Containing 5 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Q7L4P6 | |
| BEND5 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DLQLRHIKRPEGRKPSEVAHKSIEAVVARLEKQNGLSLGHSTCPEEVFVEASPGTEDMDSLEDAVVPRALYEELLRNYQQQQE | |
| 0.1 mL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| BEN domain containing 5, BEN Domain-Containing Protein 5, BEND5, C1orf165, chromosome 1 open reading frame 165, FLJ11588 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 79656 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction