BDH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Product Code	Brand	Quantity
18472741	Novus Biologicals NBP1-88673-25ul	25 μL
18700674	Novus Biologicals NBP1-88673	0.1 mL

Description

BDH1 Polyclonal specifically detects BDH1 in Human, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BDH1
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), Immunohistochemistry (Frozen)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Rat
• Gene Alias: (R)-3-hydroxybutyrate dehydrogenase, 3-hydroxybutyrate dehydrogenase, 3-hydroxybutyrate dehydrogenase, type 1, EC 1.1.1, MGC2723, MGC4347, MGC9788, mitochondrial, mitochondrial), short chain dehydrogenase/reductase family 9C, member 1
• Gene Symbols: BDH1
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of human BDH1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Immunohistochemistry-Frozen Reported in scientific literature (PMID:35902007).
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: metabolism
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 622
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:ATSLYSPESIQAIAKKMWEELPEVVRKDYGKKYFDEKIAKMETYCSSGSTDTSPVIDAVTHALTATTPYTRYHPMDYYWWLRMQIMTHL
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only