bcl10-interacting CARD protein Antibody - Azide and BSA Free, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-92715-0.02ml

Codice prodotto. 18672552

Descrizione

bcl10-interacting CARD protein Polyclonal antibody specifically detects bcl10-interacting CARD protein in Human, Mouse samples. It is validated for Western Blot

Specifica

• Antigen: bcl10-interacting CARD protein
• Classification: Polyclonal
• Dilution: Western Blot 1:500-1:2000
• Gene Alias: bA370F5.1, bcl10-interacting CARD protein, Bcl10-interacting protein with CARD, BinCARD, chromosome 9 open reading frame 89, MGC110898, MGC11115
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human CARD19 (NP_115686.3). MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHA
• Quantity: 0.02 mL
• Research Discipline: Protein Kinase
• Gene ID (Entrez): 84270
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with 50% glycerol, pH7.3.
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Form: Purified