missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
BCKDHB Polyclonal antibody specifically detects BCKDHB in Human samples. It is validated for Immunofluorescence
Specifications
Specifications
| Antigen | BCKDHB |
| Applications | Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | 2-oxoisovalerate dehydrogenase beta subunit, 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial, BCKDE1B, BCKDH E1-beta, branched chain alpha-ketoacid dehydrogenase E1-beta subunit, branched chain keto acid dehydrogenase E1, beta polypeptide, Branched-chain alpha-keto acid dehydrogenase E1 component beta chain, dJ279A18.1, E1B, E1b-beta subunit of the branched-chain complex, EC 1.2.4.4, FLJ17880 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: TIIPWDVDTICKSVIKTGRLLISHEAPLTGGFASEISSTVQEECFLNLEAPISRVCGYDTPFPHIFEPFYIPDKWKCYDAL |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?