missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BBS2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-38426-20ul
This item is not returnable.
View return policy
Description
BBS2 Polyclonal antibody specifically detects BBS2 in Mouse,Rat samples. It is validated for ELISA,Western Blot
Specifications
| BBS2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:2000, ELISA | |
| Bardet-Biedl syndrome 2, Bardet-Biedl syndrome 2 protein, BBS, MGC20703 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-96 of human BBS2 (NP_114091.3).,, Sequence:, MLLPVFTLKLRHKISPRMVAIGRYDGTHPCLAAATQTGKVFIHNPHTRNQHVSASRVFQSPLESDVSLLNINQAVSCLTAGVLNPELGYDALLVGT | |
| 20 μL | |
| Vision | |
| 583 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction