missing translation for 'onlineSavingsMsg'
Learn More
Learn More
BAT5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | BAT5 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BAT5 Polyclonal specifically detects BAT5 in Human samples. It is validated for Western Blot.Specifications
| BAT5 | |
| Polyclonal | |
| Rabbit | |
| O95870 | |
| 7920 | |
| Synthetic peptides corresponding to BAT5(HLA-B associated transcript 5) The peptide sequence was selected from the N terminal of BAT5. Peptide sequence VTAPHSSSWDTYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| abhydrolase domain containing 16A, BAT5G5, D6S82EEC 3.-, HLA-B associated transcript 5, HLA-B-associated transcript 5, NG26protein BAT5, PP199, Protein G5 | |
| ABHD16A | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title