missing translation for 'onlineSavingsMsg'
Learn More

BANF1 Antibody (M2), Novus Biologicals™

Product Code. 18320029 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18320029 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18320029 Supplier Novus Biologicals Supplier No. H00008815M07

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

BANF1 Monoclonal antibody specifically detects BANF1 in Human, Mouse, Rat samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
TRUSTED_SUSTAINABILITY

Specifications

Antigen BANF1
Applications Western Blot, ELISA, Immunocytochemistry, Immunoprecipitation
Classification Monoclonal
Clone M2
Conjugate Unconjugated
Dilution Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH05942
Gene Alias BAFMGC111161, barrier to autointegration factor 1, barrier-to-autointegration factor, BCRG1, BCRP1, Breakpoint cluster region protein 1, D14S1460
Host Species Mouse
Immunogen BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 8815
Target Species Human, Mouse, Rat
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.