missing translation for 'onlineSavingsMsg'
Få mere at vide

Novus Biologicals™ BAIAP2L1 Recombinant Protein Antigen

Produktkode 18337070 Shop alle Bio Techne produkter
missing translation for 'changeView'
missing translation for 'orderingAttributeHoverText'
Quantity:
0.1 mL
Förpackningsstorlek
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Produktkode Quantity unitSize
18337070 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Denne vare kan ikke returneres. Se returpolitik
Produktkode 18337070 missing translation for 'mfr' Novus Biologicals™ missing translation for 'supplierNo' NBP189537PEP

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolitik

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BAIAP2L1. The BAIAP2L1 Recombinant Protein Antigen is derived from E. coli. The BAIAP2L1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

This is a blocking peptide for NBP1-89537. This is a human recombinant protein expressed in E. coli with a N-terminal His-ABP tag and purified with IMAC chromatography.

TRUSTED_SUSTAINABILITY

Tekniske data

Gene ID (Entrez) 55971
Species Human
Purification Method Chromatography
Purity >80%
Concentration 0.5mg/mL
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Symbol BAIAP2L1
Label Type Unlabeled
Molecular Weight (g/mol) 26kDa
Product Type BAIAP2L1
Quantity 0.1 mL
Regulatory Status RUO
Source E.Coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89537. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Immunogen LLSFAQGDVITLLIPEEKDGWLYGEHDVSKARGWFPSSYTKLLEENETEAVTVPTPSPTPVRSISTVNLSEN
Vis mere Vis mindre

For Research Use Only

Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.