missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B7-H7/HHLA2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49187-25ul
This item is not returnable.
View return policy
Description
B7-H7/HHLA2 Polyclonal antibody specifically detects B7-H7/HHLA2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| B7-H7/HHLA2 | |
| Polyclonal | |
| Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| HERV-H LTR-associating 2, HERV-H LTR-associating protein 2, Human endogenous retrovirus-H long terminal repeat-associating protein 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IFPLAFFTYVPMNEQIVIGRLDEDIILPSSFERGSEVVIHWKYQDSYKVHSYYKGSDHLESQDPRYANRTSLFYNEIQNGNASL | |
| 25 μL | |
| Immunology, Inflammation | |
| 11148 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction