B7-H2/ICOSLG Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-68606-25ul

Product Code. 18607176

Description

B7-H2/ICOSLG Polyclonal antibody specifically detects B7-H2/ICOSLG in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: B7-H2/ICOSLG
• Classification: Polyclonal
• Dilution: Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
• Gene Alias: B7H2B7 homolog 2, B7-H2B7-related protein 1, B7RP1B7-like protein Gl50, B7RP-1LICOS, CD275, CD275 antigen, GL50transmembrane protein B7-H2 ICOS ligand, ICOSL, ICOS-L, inducible T-cell co-stimulator ligand, KIAA0653ICOS ligand
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVT
• Quantity: 25 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 23308
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified