missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B4GALNT4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-17151-100UL
This item is not returnable.
View return policy
Description
B4GALNT4 Polyclonal antibody specifically detects B4GALNT4 in Human samples. It is validated for Immunofluorescence
Specifications
| B4GALNT4 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
| B4GALNT4 beta-1,4-N-acetyl-galactosaminyl transferase 4 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: YGRDGEKLTSETDGRGVHAAPSTQRAEDSSESREEEQAPEGRDLDMLFPGGAGRLPLNFTHQTPPWREEY | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 338707 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu