B3GNT8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Marca:  Novus Biologicals NBP2-33400-25ul

Codice prodotto. 18457331

Descrizione

B3GNT8 Polyclonal specifically detects B3GNT8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifica

• Antigen: B3GNT8
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q7Z7M8
• Gene Symbols: B3GNT8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: TPANPEPTLPANLSTRLGQTIPLPFAYWNQQQWRLGSLPSGDSTETGGCQAWGAAAATEIPDFASYPKDLRRFLLSAACRSFPQWLP
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: B3GALT7, Beta Galactosyltransferase BGALT15, beta-1,3-Gn-T8, beta-1,3-N-acetylglucosaminyltransferase 8, Beta1,3-N-Acetylglucosaminyltransferase 8, beta3Gn-T8, BGALT15, BGnT-8, EC 2.4.1.-, UDP-Gal:BetaGal Beta 1,3-Galactosyltransferase Polypeptide 7, UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 374907
• Target Species: Human
• Isotype: IgG

For Research Use Only