B3GALT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-62375

Product Code. 18523514

Description

B3GALT6 Polyclonal antibody specifically detects B3GALT6 in Human samples. It is validated for Western Blot

Specifications

• Antigen: B3GALT6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose
• Gene Alias: beta-1,3-galactosyltransferase 6, Beta-1,3-GalTase 6, Beta3GalT6, Beta3Gal-T6, EC 2.4.1.134, Galactosyltransferase II, Galactosylxylosylprotein 3-beta-galactosyltransferase, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6
• Immunogen: Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected form the C terminal of B3GALT6. Peptide sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE. The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 0.5 mg/mL
• Dilution: Western Blot 1.0 μg/mL
• Gene Accession No.: Q96L58
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 126792
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG