missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B3GALT6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-62375
This item is not returnable.
View return policy
Description
B3GALT6 Polyclonal antibody specifically detects B3GALT6 in Human samples. It is validated for Western Blot
Specifications
| B3GALT6 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose | |
| beta-1,3-galactosyltransferase 6, Beta-1,3-GalTase 6, Beta3GalT6, Beta3Gal-T6, EC 2.4.1.134, Galactosyltransferase II, Galactosylxylosylprotein 3-beta-galactosyltransferase, UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6GAG GalTII, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 6 | |
| Synthetic peptides corresponding to B3GALT6(UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6) The peptide sequence was selected form the C terminal of B3GALT6. Peptide sequence VQREHDPRFDTEYRSRGCSNQYLVTHKQSLEDMLEKHATLAREGRLCKRE. The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μg | |
| Primary | |
| Human | |
| Purified |
| Western Blot | |
| 0.5 mg/mL | |
| Western Blot 1.0 μg/mL | |
| Q96L58 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 126792 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction