B3GALT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-69327

Product Code. 18254072

Description

B3GALT1 Polyclonal specifically detects B3GALT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: B3GALT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: beta-1,3-galactosyltransferase 1, Beta-1,3-GalTase 1, beta-3-galt1, beta3Gal-T1, Beta3GalT1, EC 2.4.1, EC 2.4.1.-, EC 2.4.1.62, MGC126594, UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1, UDP-galactose:beta-N-acetyl-glucosamine-beta-1,3-galactosyltransferase 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 38 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y5Z6
• Gene Symbols: B3GALT1
• Immunogen: Synthetic peptides corresponding to B3GALT1(UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1) The peptide sequence was selected from the N terminal of B3GALT1. Peptide sequence MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTF The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8708
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only