missing translation for 'onlineSavingsMsg'
Learn More
Learn More
B3GALNT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-59448
This item is not returnable.
View return policy
Description
B3GALNT1 Polyclonal specifically detects B3GALNT1 in Human samples. It is validated for Western Blot.
Specifications
| B3GALNT1 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| b3Gal-T3, Beta-1,3-galactosyltransferase 3, Beta-1,3-GalNAc-T1, Beta-1,3-GalTase 3, beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group), Beta3GalT3, Beta3Gal-T3, beta-3-Gx-T3, brainiac1, EC 2.4.1.79, Galactosylgalactosylglucosylceramide beta-D-acetyl-galactosaminyltransferase, Gb4Cer, GLCT3, Globoside synthase, globotriaosylceramide 3-beta-N-acetylgalactosaminyltransferase, P, P antigen synthase, P blood group globoside, polypeptide 3 (Globosideblood group), UDP-GalNAc:beta-1,3-N-acetylgalactosaminyltransferase 1, UDP-GalNAc:betaGlcNAc beta 1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group), UDP-GalNAc:betaGlcNAc beta-1,3-galactosaminyltransferase, polypeptide 1(Globoside blood group), UDP-N-acetylgalactosamine:globotriaosylceramidebeta-1,3-N-acetylgalactosaminyltransferase | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 8706 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| O75752 | |
| B3GALNT1 | |
| Synthetic peptides corresponding to B3GALNT1(beta-1,3-N-acetylgalactosaminyltransferase 1 (globoside blood group)) The peptide sequence was selected from the middle region of B3GALNT1. Peptide sequence PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Human: 100%; Bovine: 92%; Canine: 92%; Equine: 92%. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction