missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AXUD1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£328.00 - £513.00
Specifications
| Antigen | AXUD1 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18254452
|
Novus Biologicals
NBP2-56676 |
100 μL |
£513.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18667456
|
Novus Biologicals
NBP2-56676-25ul |
25 μL |
£328.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
AXUD1 Polyclonal specifically detects AXUD1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| AXUD1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis, Cancer, Tumor Suppressors | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 64651 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| AXIN1 up-regulated 1, Axin-1 up-regulated gene 1 protein, AXUD1DKFZp566F164, CSRNP-1, cysteine/serine-rich nuclear protein 1, cysteine-serine-rich nuclear protein 1, FAM130B, Protein URAX1, TAIP3, TAIP-3TGF-beta-induced apoptosis protein 3, TGF-beta induced apoptosis protein 3, URAX1 | |
| CSRNP1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title