missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18381900

Axotrophin Antibody, Novus Biologicals™

Product Code. 18381900 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18381900 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18381900 Supplier Novus Biologicals Supplier No. NBP276664

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

Axotrophin Polyclonal specifically detects Axotrophin in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Axotrophin
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. F5H6W4, F5H6W4
Gene Alias AXO, AXOT, Axotrophin, E3 ubiquitin-protein ligase MARCH7, EC 6.3.2, EC 6.3.2.-, MARCH-VIIDKFZp586F1122, membrane-associated ring finger (C3HC4) 7, Membrane-associated RING finger protein 7, Membrane-associated RING-CH protein VII, RING finger protein 177, RNF177axotrophin
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N-terminal region of human MARCH7 (membrane-associated ring finger (C3HC4) 7) The peptide sequence was selected from the following region: LSARMMSGSRGSSLNDTYHSRDSSFRLDSEYQSTSASASASPFQSAWYSE.
Molecular Weight of Antigen 69 kDa
Purification Method Affinity purified
Quantity 100 μL
Research Discipline Zinc Finger
Primary or Secondary Primary
Gene ID (Entrez) 64844
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.