missing translation for 'onlineSavingsMsg'
Learn More
Learn More
AWAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£362.00
Specifications
| Antigen | AWAT1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
AWAT1 Polyclonal specifically detects AWAT1 in Human samples. It is validated for Western Blot.Specifications
| AWAT1 | |
| Polyclonal | |
| Rabbit | |
| Q58HT5 | |
| 158833 | |
| Synthetic peptides corresponding to AWAT1 (acyl-CoA wax alcohol acyltransferase 1) Antibody(against the N terminal of AWAT1. Peptide sequence LLTFGAFCNFCTEATGFSKTFPGITPHLATLSWFFKIPFVREYLMAKGVC. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| acyl-CoA wax alcohol acyltransferase 1, DGA2, DGAT2L3, diacyl-glycerol acyltransferase 2, Diacylglycerol acyltransferase 2, diacylglycerol O-acyltransferase 2-like 3, Diacylglycerol O-acyltransferase 2-like protein 3, EC 2.3.1.75, Long-chain-alcohol O-fatty-acyltransferase 1 | |
| AWAT1 | |
| IgG | |
| 38 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title