missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Aurora B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55144-25ul
This item is not returnable.
View return policy
Description
Aurora B Polyclonal specifically detects Aurora B in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| Aurora B | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| AIK2EC 2.7.11.1, AIM1Aik2, AIM-1STK-1, ARK2ARK-2, AurB, aurkb-sv2, Aurora- and IPL1-like midbody-associated protein 1, aurora kinase BSerine/threonine-protein kinase aurora-B, aurora kinase B-Sv1, aurora kinase B-Sv2, Aurora/IPL1-related kinase 2, aurora-1, aurora-B, Aurora-related kinase 2, EC 2.7.11, IPL1, serine/threonine kinase 12, serine/threonine-protein kinase 12, STK12aurkb-sv1, STK5 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| AURKB | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:WPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMENSSGTPDILTRHFTID | |
| 25 μL | |
| Breast Cancer, Cancer, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, DNA Repair, Mitotic Regulators, Stem Cell Markers | |
| 9212 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction