missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Aurora A Antibody, Novus Biologicals™

Aurora A Antibody, Novus Biologicals™

Product Code. 18414072 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18414072 25 μL 25µL
18234768 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18414072 Supplier Novus Biologicals Supplier No. NBP19010325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody has been used in 1 publication

Aurora A Polyclonal specifically detects Aurora A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Aurora A
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. A3KFJ0
Gene Alias AIKAurA, ARK-1, ARK1EC 2.7.11.1, AURA, aurora kinase AhARK1, aurora/IPL1-like kinase, Aurora/IPL1-related kinase 1, Aurora-related kinase 1, Breast tumor-amplified kinase, breast-tumor-amplified kinase, BTAKAURORA2, EC 2.7.11, IPL1-related kinase, serine/threonine kinase 6, serine/threonine protein kinase 15, Serine/threonine-protein kinase 15, serine/threonine-protein kinase 6, Serine/threonine-protein kinase aurora-A, STK15serine/threonine kinase 15, STK6MGC34538, STK7
Gene Symbols AURKA
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ISGPVKATAPVGGPKRVLVTQQFPCQNPLPVNSGQAQRVLCPSNSSQRVPLQAQKLVSSHKPVQNQKQKQLQATSVPHPVSRPLNNTQKSKQPLPSAPENNPEEELASKQKNEESKKRQWALEDFEIGRPLGKGKFGNVYL
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, Core ESC Like Genes, DNA Double Strand Break Repair, DNA Repair, MAP Kinase Signaling, Mitotic Regulators, Protein Kinase, Signal Transduction, Stem Cell Markers, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 6790
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.