missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATRX Antibody, Novus Biologicals™

ATRX Antibody, Novus Biologicals™

Product Code. 18416540 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
25 μL
Unit Size:
0.1mL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Code produit Quantity unitSize
18416540 25 μL 25µL
18769573 - 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.
Code produit 18416540 Fournisseur Novus Biologicals Code fournisseur NBP18307725ul

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Description

Rabbit Polyclonal Antibody

ATRX Polyclonal specifically detects ATRX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.
TRUSTED_SUSTAINABILITY

Spécification

Antigen ATRX
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias alpha thalassemia/mental retardation syndrome X-linked, alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog), alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae), ATP-dependent helicase ATRX, ATR2, DNA dependent ATPase and helicase, EC 3.6.1, EC 3.6.4.12, helicase 2, X-linked, Juberg-Marsidi syndrome, MGC2094, MRXHF1, RAD54 homolog, RAD54L, SFM1, SHS, transcriptional regulator ATRX, XH2RAD54, X-linked helicase II, X-linked nuclear protein, XNPZNF-HX, Zinc finger helicase, Znf-HX
Gene Symbols ATRX
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 546
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Afficher plus Afficher moins

For Research Use Only

Name des Produkts
Wählen Sie ein Thema

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.