missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATRNL1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-92749-0.1ml
This item is not returnable.
View return policy
Description
ATRNL1 Polyclonal antibody specifically detects ATRNL1 in Human, Mouse samples. It is validated for Western Blot
Specifications
| ATRNL1 | |
| Polyclonal | |
| Western Blot 1:500-1:2000 | |
| attractin-like 1, bA454H24.1, FLJ45344, KIAA0534 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 53-160 of human ATRNL1 (NP_001263211.1). LYAQVSQSKPCERTGSCFSGRCVNSTCLCDPGWVGDQCQHCQGRFKLTEPSGYLTDGPINYKYKTKCTWLIEGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYAPLI | |
| 0.1 mL | |
| Endocrinology, GPCR, Neuroscience, Signal Transduction | |
| 26033 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS with 50% glycerol, pH7.3. | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction