missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atrial Natriuretic Peptide/ANP Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£164.00 - £442.00
Specifications
| Antigen | Atrial Natriuretic Peptide/ANP |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230359
|
Novus Biologicals
NBP3-35642-100ul |
100 μL |
£442.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232633
|
Novus Biologicals
NBP3-35642-20ul |
20 μL |
£164.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Atrial Natriuretic Peptide/ANP Polyclonal antibody specifically detects Atrial Natriuretic Peptide/ANP in Human,Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| Atrial Natriuretic Peptide/ANP | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| ANF, ANPatriopeptin, ATFB6, atrial natriuretic factor, Atrial natriuretic peptide, CDD-ANF, natriuretic peptide A, natriuretic peptide precursor A, PNDcardionatrin, prepronatriodilatin | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 26-151 of human Atrial Natriuretic Peptide/ANP (NP_006154.1).,, Sequence:, LTWQEIMSITELQGLNAPSEPSFEPQAPAPYLGPPPPTTYCPCSIHPDSGFPLPPPPYELPASTSHVPDPPYSYGNMAIPVSKPLSLSGLLSEPLQDPLALLDIGLPAGPPKPQEDPESDSGLSLN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:1000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 4878 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title