missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATR Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
£161.00 - £383.00
Specifications
| Antigen | ATR |
|---|---|
| Dilution | Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL |
| Applications | ELISA, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30231590
|
Novus Biologicals
NBP3-33305-20ul |
20 μL |
£161.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30229217
|
Novus Biologicals
NBP3-33305-100ul |
100 μL |
£383.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ATR Monoclonal antibody specifically detects ATR in Human,Mouse samples. It is validated for ELISA,Western BlotSpecifications
| ATR | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Breast Cancer, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Immunology, p53 Pathway, Virology Bacteria and Parasites | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 545 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse | |
| ataxia telangiectasia and Rad3 related, Ataxia telangiectasia and Rad3-related protein, EC 2.7.11.1, FRAP-related protein 1, FRP1FRAP-related protein-1, MEC1, protein kinase ATR, Rad3 related protein, SCKL1, SCKLMEC1, mitosis entry checkpoint 1, homolog, serine/threonine-protein kinase ATR | |
| A synthetic peptide corresponding to a sequence within amino acids 2100-2200 of human ATR (NP_001175.2).,, Sequence:, KAYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVLMEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNK | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title