missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18353948

ATPase Na+/K+ beta 3 Antibody, Novus Biologicals™

Product Code. 18353948 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.05 mg
Unit Size:
0.05mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18353948 0.05 mg 0.05mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18353948 Supplier Novus Biologicals Supplier No. H00000483B01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Polyclonal Antibody

ATPase Na+/K+ beta 3 Polyclonal antibody specifically detects ATPase Na+/K+ beta 3 in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry, Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATPase Na+/K+ beta 3
Applications Western Blot, Flow Cytometry, Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Formulation PBS (pH 7.4)
Gene Accession No. NP_001670.1
Gene Alias ATPase, Na+/K+ transporting, beta 3 polypeptide, ATPB-3, CD298, CD298 antigen, FLJ29027, Na, K-ATPase beta-3 polypeptide, sodium/potassium-dependent ATPase beta-3 subunit, Sodium/potassium-dependent ATPase subunit beta-3, sodium/potassium-transporting ATPase beta-3 chain, sodium/potassium-transporting ATPase subunit beta-3
Host Species Mouse
Immunogen ATP1B3 (NP_001670.1, 1 a.a. - 279 a.a.) full-length human protein. MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Purification Method Protein A purified
Quantity 0.05 mg
Regulatory Status RUO
Research Discipline Cancer, CD Markers, Endocrinology, Immunology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 483
Target Species Human, Mouse
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.