ATP9A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-88905

Product Code. 18238046

Description

ATP9A Polyclonal specifically detects ATP9A in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ATP9A
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: ATPase class II type 9A, ATPase type IV, phospholipid-transporting (P-type), ATPase, class II, type 9A, ATPIIAphospholipid-transporting ATPase IIA, EC 3.6.3, EC 3.6.3.1, KIAA0611probable phospholipid-transporting ATPase IIA
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10079
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ATP9A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MTDNIPLQPVRQKKRMDSRPRAGCCEWLRCCGG
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only