missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP7A Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£368.00
Specifications
| Antigen | ATP7A |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ATP7A Polyclonal specifically detects ATP7A in Human samples. It is validated for Western Blot.Specifications
| ATP7A | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| ATPase, Cu++ transporting, alpha polypeptide, Copper pump 1, copper-transporting ATPase 1, Cu++-transporting P-type ATPase, DSMAX, EC 3.6.3, EC 3.6.3.4, MC1, Menkes disease-associated protein, Menkes syndrome, MK, MNKFLJ17790, OHS, SMAX3 | |
| The immunogen is a synthetic peptide directed towards the middle region of Human ATP7A. Peptide sequence MGSAAMAASSVSVVLSSLFLKLYRKPTYESYELPARSQIGQKSPSEISVH | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 538 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title