missing translation for 'onlineSavingsMsg'
Learn More

ATP6V1G3 Antibody (3A5), Novus Biologicals™

Product Code. 18417599 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.1mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18417599 0.1 mg 0.1mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18417599 Supplier Novus Biologicals Supplier No. H00127124M13

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Mouse Monoclonal Antibody

ATP6V1G3 Monoclonal antibody specifically detects ATP6V1G3 in Human samples. It is validated for Western Blot, ELISA, Sandwich ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATP6V1G3
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 3A5
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_573569
Gene Alias ATPase, H+ transporting, lysosomal 13kD, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G isoform 3, ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G3, H+ transporting, lysosomal (vacuolar proton pump) subunit G3, MGC119810, MGC119813, vacuolar ATP synthase subunit G 3, vacuolar proton pump G subunit 3, Vacuolar proton pump subunit G 3, vacuolar proton pump, subunit G3, V-ATPase 13 kDa subunit 3, V-ATPase G subunit 3, V-ATPase G3 subunit, V-ATPase subunit G 3, V-type proton ATPase subunit G 3
Host Species Mouse
Immunogen ATP6V1G3 (NP_573569, 38 a.a. ∽ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EEAMVEIDQYRMQRDKEFRLKQSKIMGSQNNLSDEIEEQTLGKIQELNGHYNKYMESVMNQLLSMVCDMKPEIHVNYRATN
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 127124
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.