missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATP6V1C2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68854-25ul
This item is not returnable.
View return policy
Description
ATP6V1C2 Polyclonal antibody specifically detects ATP6V1C2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ATP6V1C2 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| ATP6C2, ATPase, H+ transporting, lysosomal 42kD, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C isoform 2, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2, Vacuolar proton pump subunit C 2, V-ATPase C2 subunit, V-ATPase subunit C 2, VMA5, V-type proton ATPase subunit C 2 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: YPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYNTLKTNLENLEKKSMGNLFTRTLSDIVSKED | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 245973 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction