ATP6V0D2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-54595

Product Code. 18270934

Description

ATP6V0D2 Polyclonal specifically detects ATP6V0D2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: ATP6V0D2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ATP6D2, ATP6V0, ATPase, H+ transporting, lysosomal 38kD, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d isoform 2, ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2, FLJ38708, Vacuolar proton pump subunit d 2, V-ATPase subunit d 2, VMA6, V-type proton ATPase subunit d 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 40 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: d 2.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N8Y2
• Gene Symbols: ATP6V0D2
• Immunogen: Synthetic peptides corresponding to ATP6V0D2(ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2) The peptide sequence was selected from the middle region of ATP6V0D2. Peptide sequence GLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSGGKTLEDVFYEREVQM
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 245972
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only