missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18322478

ATP6V0B Antibody, Novus Biologicals™

Product Code. 18322478 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18322478 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18322478 Supplier Novus Biologicals Supplier No. H00000533D01P

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ATP6V0B Polyclonal antibody specifically detects ATP6V0B in Human samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATP6V0B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS (pH 7.4)
Gene Accession No. NP_004038.1
Gene Alias ATP6FH(+)-transporting two-sector ATPase, subunit F, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 21kD, ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b, ATPase, H+ transporting, lysosomal 21kDa, V0 subunit c'', HATPL, vacuolar ATP synthase 21 kDa proteolipid subunit, Vacuolar proton pump 21 kDa proteolipid subunit, vacuolar proton pump, 21 kDa subunit, V-ATPase 21 kDa proteolipid subunit, V-ATPase subunit c'', VMA16, V-type proton ATPase 21 kDa proteolipid subunit
Host Species Rabbit
Immunogen ATP6V0B (NP_004038.1, 1 a.a. - 205 a.a.) full-length human protein. MTGLALLYSGVFVAFWACALAVGVCYTIFDLGFRFDVAWFLTETSPFMWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
Purification Method Protein G purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 533
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.