missing translation for 'onlineSavingsMsg'
Få mere at vide
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18334148

ATP5I Antibody (1E6), Novus Biologicals™

Artikelnummer. 18334148 Shop alle Bio Techne produkter
Skift visning
Klik for at se tilgængelige muligheder
Quantity:
0.1 mg
Pakningsstørrelse:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Artikelnummer. Quantity unitSize
18334148 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Denne vare kan ikke returneres. Se returpolicy
Artikelnummer. 18334148 Leverandør Novus Biologicals Leverandørnr. H00000521M01

Please to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

Mouse Monoclonal Antibody

ATP5I Monoclonal antibody specifically detects ATP5I in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Tekniske data

Antigen ATP5I
Applications ELISA
Classification Monoclonal
Clone 1E6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH03679
Gene Alias ATP synthase e chain, mitochondrial, ATP synthase subunit e, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E, ATP5K, ATPase subunit e, F1F0-ATP synthase, murine e subunit, MGC12532
Host Species Mouse
Immunogen ATP5I (AAH03679, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 521
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Vis mere Vis mindre
Produkttitel
Vælg et problem

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.