missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18334148

ATP5I Antibody (1E6), Novus Biologicals™

Product Code. 18334148 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18334148 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18334148 Supplier Novus Biologicals Supplier No. H00000521M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ATP5I Monoclonal antibody specifically detects ATP5I in Human samples. It is validated for ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATP5I
Applications ELISA
Classification Monoclonal
Clone 1E6
Conjugate Unconjugated
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH03679
Gene Alias ATP synthase e chain, mitochondrial, ATP synthase subunit e, mitochondrial, ATP synthase, H+ transporting, mitochondrial F0 complex, subunit E, ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E, ATP5K, ATPase subunit e, F1F0-ATP synthase, murine e subunit, MGC12532
Host Species Mouse
Immunogen ATP5I (AAH03679, 1 a.a. ~ 69 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARELAEDDSILK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 521
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.