missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18350169

ATP11B Antibody (4H8), Novus Biologicals™

Product Code. 18350169 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18350169 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18350169 Supplier Novus Biologicals Supplier No. H00023200M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ATP11B Monoclonal antibody specifically detects ATP11B in Human samples. It is validated for Western Blot, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATP11B
Applications Western Blot, ELISA
Classification Monoclonal
Clone 4H8
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_055431
Gene Alias ATPase class VI type 11B, ATPase IR, ATPase, class VI, type 11B, ATPIFKIAA0956probable phospholipid-transporting ATPase IF, ATPIRMGC46576, DKFZp434J238, DKFZp434N1615, EC 3.6.3, EC 3.6.3.1
Host Species Mouse
Immunogen ATP11B (NP_055431, 1087 a.a. ~ 1177 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DIIKKVFDRHLHPTSTEKAQLTETNAGIKCLDSMCCFPEGEAACASVGRMLERVIGRCSPTHISRSWSASDPFYTNDRSILTLSTMDSSTC
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Cancer, Cell Cycle and Replication
Primary or Secondary Primary
Gene ID (Entrez) 23200
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.