missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atlastin-3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
£381.00
Specifications
| Antigen | Atlastin-3 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
Atlastin-3 Polyclonal specifically detects Atlastin-3 in Human samples. It is validated for Western Blot.Specifications
| Atlastin-3 | |
| Polyclonal | |
| Rabbit | |
| atlastin 3, atlastin GTPase 3, atlastin-3, DKFZP564J0863, EC 3.6.5.- | |
| ATL3 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 25923 | |
| Synthetic peptides corresponding to DKFZP564J0863 The peptide sequence was selected from the middle region of DKFZP564J0863. Peptide sequence IYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSF. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title