missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Atlastin-2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-35616-20ul
This item is not returnable.
View return policy
Description
Atlastin-2 Polyclonal antibody specifically detects Atlastin-2 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot,Immunocytochemistry/Immunofluorescence
Specifications
| Atlastin-2 | |
| Polyclonal | |
| Western Blot 1:500 - 1:1000, ELISA, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 | |
| ADP-ribosylation factor-like 6 interacting protein 2, ADP-ribosylation factor-like protein 6-interacting protein 2, ADP-ribosylation-like factor 6 interacting protein 2, aip-2, ARL3IP2, ARL-6-interacting protein 2, ARL6IP2, atlastin GTPase 2, atlastin2, atlastin-2, EC 3.6.5.-, FLJ23293 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 390-470 of human Atlastin-2 (NP_001129145.1).,, Sequence:, ARDTYCKSMEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQLEAEIEETYANFIKHNDGKNIFY | |
| 20 μL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| ELISA, Western Blot, Immunocytochemistry/Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 64225 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction