ATG4D Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP2-49525

Product Code. 18635728

Description

ATG4D Polyclonal antibody specifically detects ATG4D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ATG4D
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: APG4 autophagy 4 homolog D, APG4 autophagy 4 homolog D (S. cerevisiae), APG4D, APG4-D, ATG4 autophagy related 4 homolog D (S. cerevisiae), AUTL4, AUT-like 4 cysteine endopeptidase, AUT-like 4, cysteine endopeptidase, AUT-like 4, cysteine endopeptidase (S. cerevisiae), Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D, cysteine protease ATG4D, cysteine protease involved in autophagy, EC 3.4.22, EC 3.4.22.-
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV
• Quantity: 0.1 mL
• Research Discipline: Autophagy
• Gene ID (Entrez): 84971
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified