missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ATG4D Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49525-25ul
This item is not returnable.
View return policy
Description
ATG4D Polyclonal antibody specifically detects ATG4D in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ATG4D | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| APG4 autophagy 4 homolog D, APG4 autophagy 4 homolog D (S. cerevisiae), APG4D, APG4-D, ATG4 autophagy related 4 homolog D (S. cerevisiae), AUTL4, AUT-like 4 cysteine endopeptidase, AUT-like 4, cysteine endopeptidase, AUT-like 4, cysteine endopeptidase (S. cerevisiae), Autophagin-4, Autophagy-related cysteine endopeptidase 4, Autophagy-related protein 4 homolog D, cysteine protease ATG4D, cysteine protease involved in autophagy, EC 3.4.22, EC 3.4.22.- | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LRKAVESCSDVTRLVVYVSQDCTVYKADVARLVARPDPTAEWKSVVILVPV | |
| 25 μL | |
| Autophagy | |
| 84971 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction