missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ATG4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

ATG4B Rabbit anti-Human, Polyclonal, Novus Biologicals™

Codice prodotto. 18353126 Sfoglia Tutto Bio Techne Prodotti
Cambia vista
Click to view available options
Quantity:
100 μg
Dimensione della confezione:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Codice prodotto. Quantity unitSize
18353126 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso
Codice prodotto. 18353126 Fornitore Novus Biologicals N. del fornitore NBP310327100UL

Please to purchase this item. Need a web account? Register with us today!

Les retours ne sont pas autorisés pour ce produit. Consulta la politica di reso

Descrizione

Rabbit Polyclonal Antibody

ATG4B Polyclonal specifically detects ATG4B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
TRUSTED_SUSTAINABILITY

Specifica

Antigen ATG4B
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS buffer, 2% sucrose
Gene Alias APG4 autophagy 4 homolog B, APG4 autophagy 4 homolog B (S. cerevisiae), APG4B, ATG4 autophagy related 4 homolog B (S. cerevisiae), AUTL1MGC1353, AUT-like 1 cysteine endopeptidase, Autophagin-1, Autophagy-related cysteine endopeptidase 1, Autophagy-related protein 4 homolog B, cysteine protease ATG4B, DKFZp586D1822, EC 3.4.22, EC 3.4.22.-, hAPG4B, KIAA0943
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human ATG4B (NP_037457). Peptide sequence LGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEIL
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Autophagy, Cancer, Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 23192
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Vedi altri risultati Mostra meno risultati
Titolo del prodotto
Selezionare un problema

Facendo clic su Invia, l'utente riconosce che potrebbe essere contattato da Fisher Scientific in merito al feedback fornito in questo modulo. Non condivideremo le vostre informazioni per altri scopi. Tutte le informazioni di contatto fornite saranno conservate in conformità con la nostra Politica sulla privacy. Informativa sulla privacy.