missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18350669

ATG12 Antibody (2H8), Novus Biologicals™

Product Code. 18350669 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18350669 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18350669 Supplier Novus Biologicals Supplier No. H00009140M01

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ATG12 Monoclonal antibody specifically detects ATG12 in Human samples. It is validated for Western Blot, ELISA, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATG12
Applications Western Blot, ELISA, Sandwich ELISA
Classification Monoclonal
Clone 2H8
Conjugate Unconjugated
Dilution Western Blot 1:500
Formulation In 1x PBS, pH 7.4
Gene Accession No. AAH11033
Gene Alias Apg12 (autophagy 12, S. cerevisiae)-like, APG12 autophagy 12-like (S. cerevisiae), APG12HAPG12, APG12-like, ATG12 autophagy related 12 homolog (S. cerevisiae), Autophagy-related protein 12, FBR93, ubiquitin-like protein ATG12, yeast) homolog
Host Species Mouse
Immunogen ATG12 (AAH11033, 1 a.a. ~ 74 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIYLCESVLCSFPRPRSWNSL
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Research Discipline Apoptosis, Autophagy, Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 9140
Target Species Human
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.