missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 18322568

ATF6 beta Antibody (4D10), Novus Biologicals™

Product Code. 18322568 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mg
Unit Size:
0.01mg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18322568 0.1 mg 0.01mg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18322568 Supplier Novus Biologicals Supplier No. H00001388M02

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Mouse Monoclonal Antibody

ATF6 beta Monoclonal antibody specifically detects ATF6 beta in Human samples. It is validated for Western Blot, ELISA, Immunocytochemistry/ Immunofluorescence, ELISA
TRUSTED_SUSTAINABILITY

Specifications

Antigen ATF6 beta
Applications Western Blot, ELISA, Immunocytochemistry, Sandwich ELISA
Classification Monoclonal
Clone 4D10
Conjugate Unconjugated
Dilution Western Blot 1:500, ELISA, Immunocytochemistry/ Immunofluorescence, Sandwich ELISA
Formulation In 1x PBS, pH 7.4
Gene Accession No. NP_004372
Gene Alias activating transcription factor 6 betacAMP-dependent transcription factor ATF-6 beta, ATF6-beta, cAMP response element-binding protein-related protein, cAMP responsive element binding protein-like 1, CREBL1CREB-RP, Creb-related protein, Creb-rp, cyclic AMP-dependent transcription factor ATF-6 beta, FLJ10066, G13cAMP-responsive element-binding protein-like 1, Protein G13
Host Species Mouse
Immunogen CREBL1 (NP_004372.3, 2 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSLDVGMDVSPSEPPWELLPIFPDLQVK
Purification Method IgG purified
Quantity 0.1 mg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1388
Target Species Human
Content And Storage Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.